Skip to main content

Table 1 Protein sequence of the Ig-like domain of human herpesvirus 8 K1 protein and derived peptides

From: The peptide derived from the Ig-like domain of human herpesvirus 8 K1 protein induces death in hematological cancer cells

K1 Ig-domain   HSLWITWYPQPVLQTLCGQPSNTVTCGQYVTLYCSTSGNYVTVW
K1 peptides   
20 amino acids S20-1 HSLWITWYPQPVLQTLCGQP (84–103)
S20-2 PVLQTLCGQPSNTVTCGQYV (94–113)
  S20-3 SNTVTCGQYVTLYCSTSGNYV (104–124)
10 amino acids S10-1 SNTVTCGQYV (104–113)
  S10-2 TVTCGQYVTL (106–115)
8 amino acids S8-1 TVTCGQYV (106–113)
  S8-2 VTLYCSTS (113–120)