Skip to main content

Table 1 The amino acid sequence and related information of ARCSP

From: Lysosomal dysfunction and autophagy blockade contribute to autophagy-related cancer suppressing peptide-induced cytotoxic death of cervical cancer cells through the AMPK/mTOR pathway

Sequence interpretation and physiochemical properties of ARCSP

Single letter code

DVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Triple letter code

Asp -Val -Ser -Ser -Ala -Leu -Asp -Lys -Leu -Lys -Glu -Phe -Gly -Asn -Thr -Leu -Glu -Asp -Lys -Ala -Arg -Glu -Leu -Ile -Ser -Arg -Ile -Lys -Gln -Ser -Glu -Leu -Ser -Ala -Lys -Met -Arg -Glu -Trp -Phe -Ser -Glu -Thr -Phe -Gln -Lys -Val -Lys -Glu -Lys -Leu -Lys -Ile -Asp –Ser

Number of residues

55

Molecular weight

6432.41 g/mol

Extinction coefficient

5690 M−1 cm−1

Iso-electric point

pH = 9.4

Net charge at pH 7

1

Estimated solubility

Good water solubility